PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G290400.1.p
Common NameSb01g028450, SORBIDRAFT_01g028450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NAC
Protein Properties Length: 354aa    MW: 38408.2 Da    PI: 6.7124
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G290400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-5261331128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatg
  Sobic.001G290400.1.p   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATTTGYWKATG 93 
                           79****************************.99**************95334445667******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+++ + +g + gl+ktLvfy+grap ge+tdWvmheyrl
  Sobic.001G290400.1.p  94 KDRRIAC-DGGVYGLRKTLVFYRGRAPGGERTDWVMHEYRL 133
                           *******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-603155IPR003441NAC domain
PROSITE profilePS5100556.9386156IPR003441NAC domain
PfamPF023656.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATTTGYWK ATGKDRRIAC DGGVYGLRKT LVFYRGRAPG  120
GERTDWVMHE YRLCQDIAHG ACNFIGAYAL CRVIKRHELQ GGEPPAGSRA KGAAASSSSG  180
SARGQMSKVS SSSSLVTSEQ LSASFTPSNS NSPPPTLDVG MFQFQSPVGV GYAGVTATAT  240
TGTGGLPWSP LPPPLLLSSS PHDTFFIGDD FPATAADESR SHAHLFGGDI MGLGSISEHE  300
LKWDSFPNTF SSGADTWNTA AVAASPTMLC RQASDGIEDL AAIFFPDDNR IVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-51115712166NAC domain-containing protein 19
4dul_A3e-51115712166NAC domain-containing protein 19
1ut7_B3e-51115712166NO APICAL MERISTEM PROTEIN
1ut7_A3e-51115712166NO APICAL MERISTEM PROTEIN
1ut4_B3e-51115712166NO APICAL MERISTEM PROTEIN
1ut4_A3e-51115712166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467457.10.0hypothetical protein SORBIDRAFT_01g028450
SwissprotA4VCM03e-73NAC45_ARATH; NAC domain-containing protein 45
TrEMBLC5WRD20.0C5WRD2_SORBI; Putative uncharacterized protein Sb01g028450
STRINGSb01g028450.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-82NAC domain containing protein 71